Recombinant Mouse CD134 / OX40L receptor protein (Fc Chimera) (ab215634)

Overview

Description

  • Nature

    Recombinant
  • Source

    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYN EAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKL GVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSL LATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGPDIEGRMDP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Molecular weight

      48 kDa including tags
    • Amino acids

      20 to 211
    • Additional sequence information

      Fc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab215634 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Lyophilized from a 0.2 µm filtered solution.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term.

  • Reconstitution
    Reconstitute with ddH2O to a concentration no less than 100 µg/mL. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • ACT 35
    • ACT35
    • ACT35 antigen
    • ATC35 antigen
    • CD 134
    • CD134
    • CD134 antigen
    • IMD16
    • Lymphoid activation antigene ACT35
    • OX 40
    • OX40
    • OX40 antigen
    • OX40 cell surface antigen
    • OX40 homologue
    • OX40L receptor
    • TAX transcriptionally activated glycoprotein 1 receptor
    • TAX transcriptionally-activated glycoprotein 1 receptor
    • TNF receptor superfamily member 4
    • TNFRSF 4
    • TNFRSF4
    • TNR4_HUMAN
    • Tumor necrosis factor receptor superfamily member 4
    • Txgp 1l
    • Txgp1
    • Txgp1l
    see all
  • Function

    Receptor for TNFSF4/OX40L/GP34.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab215634 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215634.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up