Description

  • Product name

    Recombinant Mouse CD137 protein
    See all CD137 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab208312 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRF KKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGT FNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISV TPEGGPGGHSLQVLLEHHHHHH
    • Predicted molecular weight

      19 kDa including tags
    • Amino acids

      24 to 187
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_035742. Extracellular domain

Specifications

Our Abpromise guarantee covers the use of ab208312 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • 4 1BB
    • 4 1BB ligand receptor
    • 4-1BB ligand receptor
    • 4-1BB Ligand Receptor T Cell
    • 4-1BB, mouse, homolog of
    • Antigen 4-1BB Homolog
    • CD 137
    • CD137
    • CD137 antigen
    • CDw137
    • HLDA VI
    • Homolog of mouse 4 1BB
    • ILA
    • Induced by lymphocyte activation
    • induced by lymphocyte activation (ILA)
    • Interleukin activated receptor homolog of mouse Ly63
    • Ly63, mouse, homolog of
    • MGC2172
    • OTTHUMP00000044294
    • Receptor protein 4 1BB
    • T cell antigen 4 1BB homolog
    • T cell antigen ILA
    • T-cell antigen 4-1BB homolog
    • T-cell antigen ILA
    • TNF receptor superfamily member 9
    • TNFRSF9
    • TNR9_HUMAN
    • Tumor necrosis factor receptor superfamily member 9
    see all
  • Function

    Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation.
  • Tissue specificity

    Expressed on the surface of activated T-cells.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab208312.

    Molecular Weight: 18.6 kDa (172 aa); 18-28 kDa (SDS–PAGE under reducing conditions)

References

ab208312 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208312.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up