Description

  • Product name

    Recombinant Mouse CD226 protein (His tag)
    See all CD226 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      EETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNH NMHIESNYLHRVHFL NSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEI AAPSDSYLSAEPGQD VTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRS NCSQGSMKSILIIPN AMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILPHHHHHH
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      19 to 254
    • Tags

      His tag C-Terminus
    • Additional sequence information

      corresponding to extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab215613 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µm filtered solution

  • Reconstitution
    Reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days.

General Info

  • Alternative names

    • adhesion glycoprotein
    • CD226
    • CD226 antigen
    • CD226 molecule
    • CD226_HUMAN
    • DNAM 1
    • DNAM-1
    • DNAM1
    • DNAX accessory molecule 1
    • platelet and T cell activation antigen 1
    • PTA1
    • T lineage specific activation antigen 1 antigen
    • TLiSA1
    see all
  • Function

    Receptor involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-lymphocyte (CTL) and NK cell.
  • Tissue specificity

    Expressed by peripheral blood T-lymphocytes.
  • Sequence similarities

    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab215613 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215613.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up