Recombinant mouse OX40L/TNFSF4 protein (Fc Chimera Active) (ab221205)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: Fc tag N-Terminus
- Suitable for: Functional Studies, SDS-PAGE, ELISA
Description
-
Product name
Recombinant mouse OX40L/TNFSF4 protein (Fc Chimera Active)
See all OX40L/TNFSF4 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA against immobilized Mouse OX40, His Tag (0.2μg/well). The linear range is 2-30 ng/mL.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
QLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKC DGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAF KDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL -
Predicted molecular weight
44 kDa including tags -
Amino acids
49 to 198 -
Tags
Fc tag N-Terminus -
Additional sequence information
Fused with a human IgG1 Fc tag at the N-terminus.
-
Specifications
Our Abpromise guarantee covers the use of ab221205 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
ELISA
-
Form
Lyophilized -
Additional notes
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.
pH: 7.4
Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, 0.44% L-Arginine, 0.87% Sodium chloride
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- CD 134L
- CD 252
- CD134 ligand
see all -
Function
Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. -
Involvement in disease
Genetic variations in TNFSF4 influence susceptibility to systemic lupus erythematosus (SLE) [MIM:152700]. SLE is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Note=The upstream region of TNFSF4 contains a single risk haplotype for SLE, which is correlated with increased expression of both cell-surface TNFSF4 and TNFSF4 transcripts. Increased levels of TNFSF4 are thought to augment T cell-APC interaction and the functional consequences of T cell activation, thereby destabilizing peripheral tolerance. -
Sequence similarities
Belongs to the tumor necrosis factor family. -
Cellular localization
Membrane. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab221205 has not yet been referenced specifically in any publications.