Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      EKATKRNDEECEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCK HNGTIWVPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFN SQVINSHSVTIHVRERTQNSSEHPLIISDIPDATNASGPSTMEKRPG
    • Molecular weight

      19 kDa including tags
    • Amino acids

      30 to 176
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab220466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized ab220466 at 5 μg/ml (100 μl/well) can bind Mouse B7-H4, Fc Tag with a linear range of 0.05-0.8 μg/ml.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as CD272

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • B and T lymphocyte associated protein
    • B and T lymphocyte attenuator
    • B and T lymphocyte associated
    • B- and T-lymphocyte attenuator
    • B- and T-lymphocyte-associated protein
    • BTLA
    • BTLA_HUMAN
    • BTLA1
    • CD272
    • CD272 antigen
    • FLJ16065
    • MGC129743
    see all
  • Function

    Lymphocyte inhibitory receptor which inhibits lymphocytes during immune response.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    Phosphorylated on Tyr residues by TNFRSF14 and by antigen receptors cross-linking, both inducing association with PTPN6 and PTPN11.
    N-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab220466 stained overnight with Coomassie Blue.

    The protein migrates as 30-45 kDa on a SDS-PAGE gel under reducing conditions due to glycosylation.

  • Immobilized ab220466 at 5 μg/ml (100 μl/well) can bind Mouse B7-H4, Fc Tag with a linear range of 0.05-0.8 μg/ml.

References

ab220466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up