Description

  • Product name

    Recombinant Mouse CD28 protein
    See all CD28 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVG NGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMY PPPYLDNERSNGTIIHIKEKHLCHTQSSPK
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      20 to 149
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_031668.3.

Specifications

Our Abpromise guarantee covers the use of ab207143 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD 28
    • CD28
    • CD28 antigen
    • CD28 molecule
    • CD28_HUMAN
    • MGC138290
    • T cell antigen CD28
    • T cell specific surface glycoprotein
    • T cell specific surface glycoprotein CD28
    • T-cell-specific surface glycoprotein CD28
    • TP44
    see all
  • Function

    Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival.
  • Tissue specificity

    Expressed in T-cells and plasma cells, but not in less mature B-cells.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Immobilized Mouse CD28, His Tag (ab207143) at 5 μg/mL (100 μL/well) can bind Mouse B7-1, Fc Tag (ab207101) with a linear range of 0.156-5 μg/mL 

  • DTT-reduced SDS-PAGE analysis of ab207143 stained overnight with Coomassie Blue.
    DTT-reduced protein migrates as 30-38 kDa in SDS-PAGE due to glycosylation.

References

ab207143 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207143.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up