Recombinant Mouse CD47 protein (His tag) (ab215616)
Key features and details
- Expression system: Mammalian
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Mouse CD47 protein (His tag)
See all CD47 proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Mammalian -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIY DGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELS REGKTVIELKNRTAFNTDQGSACSYEEEKG GCKLVSWFSPVDHHHHHH -
Predicted molecular weight
17 kDa including tags -
Amino acids
19 to 158 -
Tags
His tag C-Terminus -
Additional sequence information
from Isoform 2
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab215616 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS -
ReconstitutionReconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
General Info
-
Alternative names
- Antigen identified by monoclonal antibody 1D8
- Antigenic surface determinant protein OA3
- CD 47
see all -
Function
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. -
Tissue specificity
Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain. -
Sequence similarities
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab215616 has not yet been referenced specifically in any publications.