Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      DCGPPPDIPNARPILGRHSKFAEQSKVAYSCNNGFKQVPDKSNIVVCLEN GQWSSHETFCEKSCVAPERLSFASLKKEYLNMNFFPVGTIVEYECRPGFR KQPPLPGKATCLEDLVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGS EINFSCNPGYRLVGVSSTFCSVTGNTVDWDDEFPVCTEIHCPEPPKINNG IMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPRC IEKSKVPTKKPTINVPSTGTPSTPQKPTTESVPNPGDQPTPQKPSTVKVS ATQHVPVTKTTVRHPIRTSTDKGEPNTGLEHHHHHH
    • Molecular weight

      37 kDa including tags
    • Amino acids

      35 to 362
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NCBI Accession No. NP_034146. Full-length recombinant mature protein without the signal peptide and propeptide.

Specifications

Our Abpromise guarantee covers the use of ab219234 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab219234 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • CD 55
    • CD55
    • CD55 antigen
    • CD55 Cromer blood group system
    • CD55 molecule
    • CD55 molecule (Cromer blood group)
    • CD55 molecule, decay accelerating factor for complement (Cromer blood group)
    • Cd55a
    • Complement decay accelerating factor
    • Complement decay-accelerating factor
    • Complement decay-accelerating factor, GPI-anchored
    • CR
    • CROM
    • Cromer Blood Group antigen
    • Cromer blood group system
    • DAF
    • Daf-GPI
    • DAF_HUMAN
    • Daf1
    • Dcay accelerating factor for complement (CD55, Cromer blood group system)
    • Decay accelarating factor 1, isoform CRA_a
    • Decay accelerating factor (GPI-form)
    • Decay Accelerating Factor for Complement
    • Decay accelerating factor GPI-form
    • Decay accelerating factor soluble-form
    • GPI-DAF
    • TC
    see all
  • Function

    This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade.
  • Tissue specificity

    Expressed on the plasma membranes of all cell types that are in intimate contact with plasma complement proteins. It is also found on the surfaces of epithelial cells lining extracellular compartments, and variants of the molecule are present in body fluids and in extracellular matrix.
  • Sequence similarities

    Belongs to the receptors of complement activation (RCA) family.
    Contains 4 Sushi (CCP/SCR) domains.
  • Domain

    The first Sushi domain (SCR1) is not necessary for function. SCR2 and SCR4 provide the proper conformation for the active site on SCR3.
  • Post-translational
    modifications

    The Ser/Thr-rich domain is heavily O-glycosylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab219234 (3 μg).

References

ab219234 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219234.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up