Description

  • Product name

    Recombinant Mouse CD62L protein
    See all CD62L proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      QCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAET QCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNC SEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYN
    • Predicted molecular weight

      20 kDa including tags
    • Amino acids

      190 to 332

Specifications

Our Abpromise guarantee covers the use of ab205901 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Sandwich ELISA

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.29% Sodium chloride, 0.01% EDTA, 0.61% Tris, 1% Glycine, 8.7% DL-Arginine, 0.01% Glutathione, 10% Glycerol

General Info

  • Alternative names

    • A.11
    • AI528707
    • CD62 antigen ligand
    • CD62 antigen-like family member L
    • CD62L
    • gp90-MEL
    • IgA nephropathy, susceptibility to, included
    • L Selectin
    • L-selectin
    • LAM-1
    • LAM1
    • LECAM1
    • LEU8
    • Leukocyte adhesion molecule 1
    • Leukocyte surface antigen Leu-8
    • Leukocyte-endothelial cell adhesion molecule 1
    • Lnhr
    • LSEL
    • Ly-22
    • Ly-m22
    • Lyam-1
    • LYAM1
    • LYAM1_HUMAN
    • Lymph node homing receptor
    • Lymphocyte adhesion molecule 1
    • Lymphocyte antigen 22
    • Lymphocyte surface MEL-14 antigen
    • MEL-14
    • Pln homing receptor
    • PLNHR
    • Selectin L
    • Selectin, lymphocyte
    • SELL
    • TQ1
    see all
  • Function

    Cell surface adhesion protein. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
  • Tissue specificity

    Expressed in B cell lines and T lymphocytes.
  • Sequence similarities

    Belongs to the selectin/LECAM family.
    Contains 1 C-type lectin domain.
    Contains 1 EGF-like domain.
    Contains 2 Sushi (CCP/SCR) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab205901 (1μg) stained with colloidal coomassie blue.

References

ab205901 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205901.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up