Bioactive grade

Recombinant mouse CD64 protein (Active) (ab220550)

Description

  • Product name

    Recombinant mouse CD64 protein (Active)
    See all CD64 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA against immobilized OKT3 mAb (mouse IgG2a, 0.2μg/well). The linear range is 0.4-3 ng/ml.

    The bioactivity is measured by its binding ability to mouse IgG2a in a SPR assay. Immobilized ab220550 can bind mouse IgG2a with affinity constant of around 6.1 nM (routinely tested).

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      EVVNATKAVITLQPPWVSIFQKENVTLWCEGPHLPGDSSTQWFINGTAVQ ISTPSYSIPEASFQDSGEYRCQIGSSMPSDPVQLQIHNDWLLLQASRRVL TEGEPLALRCHGWKNKLVYNVVFYRNGKSFQFSSDSEVAILKTNLSHSGI YHCSGTGRHRYTSAGVSITVKELFTTPVLRASVSSPFPEGSLVTLNCETN LLLQRPGLQLHFSFYVGSKILEYRNTSSEYHIARAEREDAGFYWCEVATE DSSVLKRSPELELQVLGPQSSAP
    • Predicted molecular weight

      31 kDa including tags
    • Amino acids

      25 to 297
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_034316).

Specifications

Our Abpromise guarantee covers the use of ab220550 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD 64
    • CD64
    • CD64 antigen
    • CD64A
    • CD64b
    • CD64c
    • Fc fragment of IgG high affinity Ia receptor
    • Fc fragment of IgG high affinity Ib receptor
    • Fc fragment of IgG high affinity Ic receptor
    • Fc fragment of IgG, high affinity Ia, receptor (CD64)
    • Fc fragment of IgG, high affinity Ia, receptor for
    • Fc fragment of IgG, high affinity Ia, receptor for (CD64)
    • Fc fragment of IgG, high affinity Ib, receptor (CD64)
    • Fc fragment of IgG, high affinity Ib, receptor for
    • Fc fragment of IgG, high affinity Ic, receptor (CD64)
    • Fc fragment of IgG, high affinity Ic, receptor (CD64), pseudogene
    • Fc fragment of IgG, high affinity Ic, receptor for
    • Fc gamma receptor
    • Fc gamma receptor I
    • Fc gamma receptor I A1
    • Fc gamma receptor I B2
    • Fc gamma RI
    • Fc gamma RIA
    • Fc gamma RIB
    • Fc of IgG high affinity Ia receptor
    • Fc-gamma RI
    • Fc-gamma RIA
    • Fc-gamma RIC
    • FCG 1
    • FCG1
    • FcgammaRI
    • FcgammaRIa
    • FCGR 1
    • FCGR1
    • FCGR1_HUMAN
    • FCGR1A
    • FCGR1B
    • FCGR1C
    • FcRI
    • FcRIB
    • FCRIC
    • FLJ18345
    • HFcgammaRIB
    • High affinity immunoglobulin gamma Fc receptor I
    • High affinity immunoglobulin gamma Fc receptor IB
    • IGFR 1
    • IGFR1
    • IGFRB
    • IGFRC
    • IgG Fc receptor I
    • IgG Fc receptor IB
    • IgG Fc receptor IC
    • Immunoglobulin G Fc receptor I
    • Immunoglobulin G Fc receptor IB
    • Immunoglobulin G Fc receptor IC
    • MGC137713
    see all
  • Function

    High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
  • Tissue specificity

    Monocyte/macrophage specific.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. FCGR1 family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    Phosphorylated on serine residues.
  • Cellular localization

    Cell membrane. Stabilized at the cell membrane through interaction with FCER1G.
  • Information by UniProt

Images

  • Captured Mouse Fc gamma RI, His Tag on NTA-Series S sensor chip can bind Herceptin® (Trastuzumab) with an affinity constant of 63.8 nM as determined in a SPR assay (Biacore T200).
  • Mouse CD64, His Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • Immobilized Anti-CD3 epsilon MAb, Mouse IgG2a at 2 µg/mL (100 µL/well) can bind Mouse Fc gamma RI, His Tag with a linear range of 0.5-2 ng/mL.
  • SDS-PAGE analysis of ab220550 stained overnight with Coomassie Blue.

    The protein migrates as 40-55 kDa under reducing conditions (SDS-PAGE) due to glycosylation.

References

ab220550 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220550.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up