Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      WELTILHTNDVHSRLEQTSDDSTKCLNASLCVGGVARLFTKVQQIRKEEP NVLFLDAGDQYQGTIWFTVYKGLEVAHFMNILGYDAMALGNHEFDNGVEG LIDPLLRNVKFPILSANIKARGPLAHQISGLFLPSKVLSVGGEVVGIVGY TSKETPFLSNPGTNLVFEDEISALQPEVDKLKTLNVNKIIALGHSGFEMD KLIAQKVRGVDIVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTADDGRQVP VVQAYAFGKYLGYLKVEFDDKGNVITSYGNPILLNSSIPEDATIKADINQ WRIKLDNYSTQELGRTIVYLDGSTQTCRFRECNMGNLICDAMINNNLRHP DEMFWNHVSMCIVNGGGIRSPIDEKNNGTITWENLAAVLPFGGTFDLVQL KGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDINRKPWNRVVQLEVLC TKCRVPIYEPLEMDKVYKVTLPSYLANGGDGFQMIKDELLKHDSGDQDIS VVSEYISKMKVVYPAVEGRIKFSLEHHHHHH
    • Molecular weight
      59 kDa including tags
    • Amino acids
      29 to 551
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Nucleotidase domain lacking the signal peptide and the propeptide.

Specifications

Our Abpromise guarantee covers the use of ab223023 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity is > 8,000 pmol/min/ug, and is defined as the amount of enzyme that hydrolyzes 1.0 pmole of Adenosine 5′- monophosphate to phosphate per minute per minute at pH 7.5 at 25C.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >90% by SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: PBS, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 5' NT
    • 5' nucleotidase (CD73)
    • 5' nucleotidase precursor
    • 5' nucleotidase, ecto
    • 5' nucleotidase, ecto (CD73)
    • 5'-NT
    • 5'-nucleotidase
    • 5NTD_HUMAN
    • CD73
    • CD73 antigen
    • E5NT
    • Ecto 5' nucleotidase
    • Ecto-5'-nucleotidase
    • eN
    • eNT
    • NT
    • NT5
    • NT5E
    • NTE
    • Purine 5 Prime Nucleotidase
    see all
  • Function
    Hydrolyzes extracellular nucleotides into membrane permeable nucleosides.
  • Involvement in disease
    Defects in NT5E are the cause of calcification of joints and arteries (CAJA) [MIM:211800]. A condition characterized by adult-onset calcification of the lower extremity arteries, including the iliac, femoral and tibial arteries, and hand and foot capsule joints. Age of onset has been reported as early as the second decade of life, usually involving intense joint pain or calcification in the hands.
  • Sequence similarities
    Belongs to the 5'-nucleotidase family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 3 μg ab223023 analysed by 15% SDS-PAGE.

References

ab223023 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223023.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up