Bioactive grade

Recombinant mouse CD80 protein (Active) (ab220537)

Description

  • Product name

    Recombinant mouse CD80 protein (Active)
    See all CD80 proteins and peptides
  • Biological activity

    Immobilized ab220537 at 2 μg/mL (100 μL/well) can bind Mouse CTLA-4, Fc Tag  with a linear range of 0.12-0.5 ng/mL.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKV WPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALV KLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPG INTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKP PEDPPDSK
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      38 to 245
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab220537 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Activation B7-1 antigen
    • B lymphocyte activation antigen B7
    • B7
    • B7-1
    • B7-1 antigen
    • B7.1
    • BB1
    • CD28 antigen ligand 1
    • CD28LG
    • CD28LG1
    • CD80
    • CD80 antigen
    • CD80 antigen (CD28 antigen ligand 1, B7-1 antigen)
    • CD80 molecule
    • CD80_HUMAN
    • Costimulatory factor CD80
    • costimulatory molecule variant IgV-CD80
    • CTLA-4 counter-receptor B7.1
    • LAB7
    • T-lymphocyte activation antigen CD80
    see all
  • Function

    Involved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28 or CTLA-4 to this receptor.
  • Tissue specificity

    Expressed on activated B-cells, macrophages and dendritic cells.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Immobilized ab220537 at 2 μg/mL (100 μL/well) can bind Mouse CTLA-4, Fc Tag  with a linear range of 0.12-0.5 ng/mL.

  • SDS-PAGE analysis of reduced ab220537 stained overnight with Coomassie Blue.  As a result of glycosylation, the reduced protein migrates as 40-55 kDa.

References

ab220537 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220537.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up