Description

  • Product name

    Recombinant Mouse CD83 protein (Fc Chimera)
    See all CD83 proteins and peptides
  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 0.600 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNS SFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCP KEATESTFRKYRAE
    • Predicted molecular weight

      13 kDa
    • Amino acids

      22 to 135
    • Additional sequence information

      Fused to the N-terminus of the Fc region of mouse IgG2a (NP_033986.1).

Specifications

Our Abpromise guarantee covers the use of ab214598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.

    Constituent: 100% PBS

    Lyophilized from 0.2 µm-filtered solution.

  • Reconstitution
    Reconstitute at 100 µg/mL in sterile PBS.

General Info

  • Alternative names

    • B cell activation 45kDa cell surface glycoprotein Ig superfamily
    • B cell activation protein
    • B-cell activation protein
    • BL11
    • BL11 PEN
    • CD83
    • CD83 antigen
    • CD83 antigen (activated B lymphocytes, immunoglobulin superfamily)
    • CD83 molecule
    • CD83_HUMAN
    • Cell surface glycoprotein
    • Cell surface protein HB15
    • HB15
    • hCD83
    see all
  • Function

    May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.
  • Tissue specificity

    Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab214598 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up