Recombinant mouse CD86 protein (ab207110)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, ELISA, SDS-PAGE
Description
-
Product name
Recombinant mouse CD86 protein
See all CD86 proteins and peptides -
Biological activity
Immobilized mouse CD86 protein (ab207110) at 2 μg/mL (100 μL/well) can bind recombinant rat CTLA4 protein (Fc Chimera) (ab219717) with a linear range of 0.2-3 ng/mL.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTE KLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIIL QQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLI TNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESM KISSKPLNFTQEFPSPQTYWKE -
Predicted molecular weight
27 kDa including tags -
Amino acids
24 to 245 -
Tags
His tag C-Terminus -
Additional sequence information
Extracellular domain (NP_062261.3).
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab207110 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
ELISA
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product is stable after storage at:
• -20°C to -70°C for 12 months in lyophilized state;
• -70°C for 3 months under sterile conditions after reconstitution. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.
pH: 7.40
Constituents: 95% PBS, 5% Trehalose
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- Activation B7-2 antigen
- Activation B7-2 antigen 3
- B-lymphocyte activation antigen B7-2
see all -
Function
Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation. -
Tissue specificity
Expressed by activated B-lymphocytes and monocytes. -
Sequence similarities
Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Post-translational
modificationsPolyubiquitinated; which is promoted by MARCH8 and results in endocytosis and lysosomal degradation. -
Cellular localization
Membrane. - Information by UniProt
Images
-
Immobilized mouse CD86 protein (ab207110) at 2 μg/mL (100 μL/well) can bind recombinant rat CTLA4 protein (Fc Chimera) (ab219717) with a linear range of 0.2-3 ng/mL.
-
DTT-reduced SDS-PAGE analysis of ab207110 stained overnight with Coomassie Blue.
DTT-reduced protein migrates as 40-55 kDa in SDS-PAGE due to glycosylation.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab207110 has not yet been referenced specifically in any publications.