Recombinant Mouse CELA2A protein (His tag) (ab235732)

Description

  • Product name

    Recombinant Mouse CELA2A protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNY QTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLA SPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRL LVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQ WQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      31 to 271
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full length mature protein without the signal peptide (1-16aa) and without propeptide (17-30aa). N-terminal 6xHis-tagged.

Specifications

Our Abpromise guarantee covers the use of ab235732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • CEL2A_HUMAN
    • Cela2a
    • Chymotrypsin-like elastase family member 2A
    • Elastase-2A
  • Function

    Acts upon elastin.
  • Tissue specificity

    Pancreas.
  • Sequence similarities

    Belongs to the peptidase S1 family. Elastase subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel using ab235732.

References

ab235732 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up