Bioactive grade

Recombinant mouse CES3/TGH protein (Active) (ab219457)

Description

  • Product name

    Recombinant mouse CES3/TGH protein (Active)
    See all CES3/TGH proteins and peptides
  • Biological activity

    Specific activity is > 80,000 pmol/min/ug and is defined as the amount of enzyme that hydrolyze 1 pmole of p-nitrophenyl acetate to p-nitrophenol per minute at pH 7.5 at 37 degrees.

  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      YPSSPPVVNT VKGKVLGKYV NLEGFTQPVAVFLGVPFAKP PLGSLRFAPPQPAEPWSFVKNTTSYPPMCSQDAVGGQVLSELFTNRKENI PLQFSEDCLYLNIYTPADLTKNSRLPVMVWIHGGGLVVGGASTYDGLALS AHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIANF GGNPGSVTIFGESAGGFSVSVLVLSPLAKNLFHRAISESGVSLTAALITT DVKPIAGLVATLSGCKTTTSAVMVHCLRQKTEDELLETSLKLNLFKLDLL GNPKESYPFLPTVIDGVVLPKAPEEILAEKSFSTVPYIVGINKQEFGWII PTLMGYPLAEGKLDQKTANSLLWKSYPTLKISENMIPVVAEKYLGGTDDL TKKKDLFQDLMADVVFGVPSVIVSRSHRDAGASTYMYEFEYRPSFVSAMR PKAVIGDHGDEIFSVFGSPFLKDGASEEETNLSKMVMKFWANFARNGNPN GGGLPHWPEYDQKEGYLKIGASTQAAQRKDKEVSFWAELRAKESAQRPSH REHVELLEHHHHHH
    • Predicted molecular weight

      61 kDa including tags
    • Amino acids

      19 to 565
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature protein without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab219457 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as CES3

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 90% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Carboxylesterase 3
    • CES 3
    • Ces3
    • ES3
    • EST3_HUMAN
    • FLJ21736
    • Liver carboxylesterase 31 homolog
    see all
  • Function

    Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Shows low catalytic efficiency for hydrolysis of CPT-11 (7-ethyl-10-[4-(1-piperidino)-1-piperidino]-carbonyloxycamptothecin), a prodrug for camptothecin used in cancer therapeutics.
  • Tissue specificity

    Expressed in liver, colon and small intestine.
  • Sequence similarities

    Belongs to the type-B carboxylesterase/lipase family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • 15% SDS-PAGE using 3ug of ab219457.

References

ab219457 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219457.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up