Recombinant Mouse Complement factor B protein (His tag) (ab226229)

Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      TPVLEARPQVSCSLEGVEIKGGSFQLLQGGQALEYLCPSGFYPYPVQTRT CRSTGSWSDLQTRDQKIVQKAECRAIRCPRPQDFENGEFWPRSPFYNLSD QISFQCYDGYVLRGSANRTCQENGRWDGQTAICDDGAGYCPNPGIPIGTR KVGSQYRLEDIVTYHCSRGLVLRGSQKRKCQEGGSWSGTEPSCQDSFMYD SPQEVAEAFLSSLTETIEGADAEDGHSPGEQQKRKIVLDPSGSMNIYLVL DGSDSIGSSNFTGAKRCLTNLIEKVASYGVRPRYGLLTYATVPKVLVRVS DERSSDADWVTEKLNQISYEDHKLKSGTNTKRALQAVYSMMSWAGDAPPE GWNRTRHVIIIMTDGLHNMGGNPVTVIQDIRALLDIGRDPKNPREDYLDV YVFGVGPLVDSVNINALASKKDNEHHVFKVKDMEDLENVFYQMIDETKSL SLCGMVWEHKKGNDYHKQPWQAKISVTRPLKGHETCMGAVVSEYFVLTAA HCFMVDDQKHSIKVSVGGQRRDLEIEEVLFHPKYNINGKKAEGIPEFYDY DVALVKLKNKLKYGQTLRPICLPCTEGTTRALRLPQTATCKQHKEQLLPV KDVKALFVSEQGKSLTRKEVYIKNGDKKASCERDATKAQGYEKVKDASEV VTPRFLCTGGVDPYADPNTCKGDSGGPLIVHKRSRFIQVGVISWGVVDVC RDQRRQQLVPSYARDFHINLFQVLPWLKDKLKDEDLGFL
    • Molecular weight

      87 kDa including tags
    • Amino acids

      23 to 761
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab226229 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • C3/C5 convertase
    • Complement factor B
    • Glycine-rich beta glycoprotein
    • PBF2
    • Properdin factor B
    see all
  • Relevance

    Factor B which is part of the alternate pathway of the complement system is cleaved by factor D into 2 fragments: Ba and Bb. Bb, a serine protease, then combines with complement factor 3b to generate the C3 or C5 convertase. It has also been implicated in proliferation and differentiation of preactivated B-lymphocytes, rapid spreading of peripheral blood monocytes, stimulation of lymphocyte blastogenesis and lysis of erythrocytes. Ba inhibits the proliferation of preactivated B-lymphocytes.
  • Cellular localization

    Plasma membrane and Secreted

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab226229 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226229.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up