Description

  • Product name

    Recombinant Mouse Cortisol Binding Globulin protein
    See all Cortisol Binding Globulin proteins and peptides
  • Purity

    > 95 % Densitometry.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      VTDEDSSSHRDLAPTNVDFAFNLYKRLVALNSDKNTLISPVSISMALAML SLSTRGSTQYLENLGFNMSKMSEAEIHQGFQYLNSLLQQSDTGLEMNMGN VMFLLQNLKLKDSFLADTKHYYESEALTIPSKDWTKAGEQINNHVKNKTQ GKIEHVVSDLDSSATLILINYIFLKGIWKLPFSPENTREEDFYVNETSTV KVPMMVQSGNISYFRDSAIPCQMVQMNYVGNGTTFIILPDQGQMDTVVAA LNRDTIDRWGKLMIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQS DFADTTKDTPLTLTVLHKAMLQLDEGNVLPAATNGPPVHLPSESFTLKYN RPFIFLAFDKYTWSSLMMSQVMNPAHHHHHHHHH
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      23 to 397
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 23 to 397. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab207130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 100% PBS

    Lyophilised from a 0.4 µm filtered solution.

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilised pellet dissolve completely.

General Info

  • Alternative names

    • CBG
    • CBG_HUMAN
    • corticosteroid binding globulin
    • Corticosteroid-binding globulin
    • serine (or cysteine) proteinase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 6
    • Serpin A6
    • serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 6
    • Serpina6
    • Transcortin
    see all
  • Function

    Major transport protein for glucocorticoids and progestins in the blood of almost all vertebrate species.
  • Tissue specificity

    Plasma; synthesized in liver. Has also been identified in a number of glycocorticoid responsive cells.
  • Involvement in disease

    Defects in SERPINA6 are a cause of corticosteroid-binding globulin deficiency (CBG deficiency) [MIM:611489]. CBG deficiency is an extremely rare hereditary disorder characterized by reduced corticosteroid-binding capacity with normal or low plasma corticosteroid-binding globulin concentration, and normal or low basal cortisol levels associated with hypo/hypertension and muscle fatigue.
  • Sequence similarities

    Belongs to the serpin family.
  • Post-translational
    modifications

    N-glycosylated; binds 5 oligosaccharide chains.
    Glycosylation in position Asn-260 is needed for steroid binding.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 14 % SDS-PAGE analysis of ab207130.

    Lane 1: Reduced and boiled sample, 2.5 μg/lane.
    Lane 2: Non-reduced and non-boiled sample, 2.5 μg/lane.

References

ab207130 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207130.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up