Description

  • Product name

    Recombinant mouse CT-1 protein
    See all CT-1 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard.

    The ED50 as determined by a cell proliferation assay using Human TF1 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 106 IU/mg.

  • Purity

    > 95 % SDS-PAGE.
    >95% by HPLC analysis.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MSQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQ QQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPAL LDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGP GPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPG GVA
    • Predicted molecular weight

      22 kDa
    • Amino acids

      1 to 203
    • Additional sequence information

      Single non-glycosylated polypeptide chain.

Specifications

Our Abpromise guarantee covers the use of ab201409 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as Cardiotrophin 1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.50
    Constituents: 1.74% Sodium chloride, 0.24% Tris

    Lyophilised from a 0.2µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at -20°C to -70°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • Cardiophin 1
    • Cardiophin1
    • Cardiotrophin I
    • Cardiotrophin-1
    • Cardiotrophin1
    • CardiotrophinI
    • CT 1
    • CT-1
    • CT1
    • CTF 1
    • Ctf1
    • CTF1_HUMAN
    see all
  • Function

    Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor.
  • Tissue specificity

    Highly expressed in heart, skeletal muscle, prostate and ovary. Lower levels in lung, kidney, pancreas, thymus, testis and small intestine. Little or no expression in brain, placenta, liver, spleen, colon or peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the IL-6 superfamily.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab201409 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201409.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up