Overview

Description

  • Nature

    Recombinant
  • Source

    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSK SVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEG TPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPE AEANEKQQDDRQQEAPGAGASTPAWVDHHHHHH
    • Molecular weight

      20 kDa including tags
    • Amino acids

      27 to 201
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab185839 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Reconstitute for long term storage.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS. Please aliquot the reconstituted solution

General Info

  • Alternative names

    • C-X-C motif chemokine 16
    • Chemokine (C X C motif) ligand 16
    • Chemokine, CXC motif, ligand 16
    • CXC chemokine ligand 16
    • Cxcl16
    • CXCLG16
    • CXL16_HUMAN
    • Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein
    • SCYB16
    • Small inducible cytokine B16 precursor
    • Small-inducible cytokine B16
    • SR-PSOX
    • SRPSOX
    • Transmembrane chemokine CXCL16
    • UNQ2759/PRO6714
    see all
  • Function

    Acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis (By similarity). Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo.
  • Tissue specificity

    Expressed in T-cell areas. Expressed in spleen, lymph nodes, lung, kidney, small intestine and thymus. Weak expression in heart and liver and no expression in brain and bone marrow.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications

    Glycosylated.
  • Cellular localization

    Cell membrane. Secreted. Also exists as a soluble form.
  • Information by UniProt

References

ab185839 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185839.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up