Description

  • Product name

    Recombinant Mouse Cystatin F protein
    See all Cystatin F proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      ARPPDFCSKDLISSVKPGFPKTIETNNPGVLKAARHSVEKFNNCTNDIFL FKESHVSKALVQVVKGLKYMLEVKIGRTTCRKTMHHQLDNCDFQTNPALK RTLYCYSEVWVIPWLHSFEVPVLLCQVDHHHHHH
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      19 to 144
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185420 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.24% Tris, 0.88% Sodium chloride

General Info

  • Alternative names

    • CMAP
    • CST 7
    • Cst7
    • Cystatin 7
    • cystatin F (leukocystatin)
    • Cystatin like metastasis associated protein
    • Cystatin-7
    • Cystatin-F
    • Cystatin-like metastasis-associated protein
    • Cystatin7
    • CystatinF
    • CYTF_HUMAN
    • dJ568C11.1
    • Leukocystatin
    see all
  • Function

    Inhibits papain and cathepsin L but with affinities lower than other cystatins. May play a role in immune regulation through inhibition of a unique target in the hematopoietic system.
  • Tissue specificity

    Primarily expressed in peripheral blood cells and spleen.
  • Sequence similarities

    Belongs to the cystatin family.
  • Cellular localization

    Secreted. Cytoplasm.
  • Information by UniProt

References

ab185420 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185420.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up