Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMSQAEFDKAAEEVKRLKTQPTDEEMLF IYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEK VDELKKKYG
    • Molecular weight

      12 kDa including tags
    • Amino acids

      1 to 87
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_031856.

Specifications

Our Abpromise guarantee covers the use of ab229507 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 95 % SDS-PAGE.
    ab229507 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Diazepam Binding Inhibitor

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

General Info

  • Alternative names

    • ACBD 1
    • ACBD1
    • ACBP
    • ACBP_HUMAN
    • Acyl CoA binding domain containing 1
    • Acyl CoA binding protein
    • Acyl Coenzyme A binding domain containing 1
    • Acyl coenzyme A binding protein
    • Acyl-CoA-binding protein
    • CCK RP
    • CCKRP
    • Cholecystokinin releasing peptide trypsin sensitive
    • DBI
    • Diazepam-binding inhibitor
    • Endozepine
    • EP
    • GABA receptor modulator
    • MGC70414
    see all
  • Function

    Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
  • Tissue specificity

    Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart.
  • Sequence similarities

    Belongs to the ACBP family.
    Contains 1 ACB (acyl-CoA-binding) domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab229507.

References

ab229507 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229507.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up