Description

  • Product name

    Recombinant Mouse Decorin protein
    See all Decorin proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab206790 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      GPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLG LDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKIS PEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFN GLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPT SLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHL RELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRK ASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYKHHHHHH
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      17 to 354
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included. NP_001177380.

Specifications

Our Abpromise guarantee covers the use of ab206790 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 30% Glycerol, 0.00174% PMSF, 69% PBS

General Info

  • Alternative names

    • Bone proteoglycan II
    • CSCD
    • DCN
    • DCN protein
    • Decorin
    • Decorin proteoglycan
    • Dermatan sulphate proteoglycans II
    • DKFZp686J19238
    • DSPG 2
    • DSPG2
    • PG 40
    • PG II
    • PG S2
    • PG-S2
    • PG40
    • PGII
    • PGS 2
    • PGS2
    • PGS2_HUMAN
    • Proteoglycan core protein
    • SLRR1B
    • Small leucine rich protein 1B
    see all
  • Function

    May affect the rate of fibrils formation.
  • Involvement in disease

    Defects in DCN are the cause of congenital stromal corneal dystrophy (CSCD) [MIM:610048]. Corneal dystrophies are inherited, bilateral, primary alterations of the cornea that are not associated with prior inflammation or secondary to systemic disease. Most show autosomal dominant inheritance.
  • Sequence similarities

    Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class I subfamily.
    Contains 12 LRR (leucine-rich) repeats.
  • Post-translational
    modifications

    The attached glycosaminoglycan chain can be either chondroitin sulfate or dermatan sulfate depending upon the tissue of origin.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab206790 (3μg). MW: 40-57kDa (SDS–PAGE under reducing conditions.)

References

ab206790 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206790.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up