Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      PSPTVTWTPAEPGPALNYPQEEATLNEMFREVEELMEDTQHKLRSAVEEM EAEEAAAKTSSEVNLASLPPNYHNETSTETRVGNNTVHVHQEVHKITNNQ SGQVVFSETVITSVGDEEGKRSHECIIDEDCGPTRYCQFSSFKYTCQPCR DQQMLCTRDSECCGDQLCAWGHCTQKATKGGNGTICDNQRDCQPGLCCAF QRGLLFPVCTPLPVEGELCHDPTSQLLDLITWELEPEGALDRCPCASGLL CQPHSHSLVYMCKPAFVGSHDHSEESQLPREAPDEYEDVGFIGEVRQELE DLERSLAQEMAFEGPAPVESLGGEEEI
    • Molecular weight

      37 kDa including tags
    • Amino acids

      23 to 349
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 23 to 349. The signal peptide is not included (NP_056629.1).

Specifications

Our Abpromise guarantee covers the use of ab207108 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    Reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Dickkopf 3
    • Dickkopf 3 homolog
    • Dickkopf 3 homolog (Xenopus laevis)
    • Dickkopf homolog 3
    • Dickkopf related protein 3
    • Dickkopf related protein 3 Precursor
    • Dickkopf WNT signaling pathway inhibitor 3
    • Dickkopf, Xenopus, homolog of, 3
    • Dickkopf-3
    • Dickkopf-related protein 3
    • Dickkopf3
    • DKK 3
    • Dkk-3
    • DKK3
    • DKK3_HUMAN
    • hDkk 3
    • hDkk-3
    • hDkk3
    • Regulated in glioma
    • REIC
    • RIG
    • RIG-like 5-6
    • RIG-like 7-1
    see all
  • Function

    Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
  • Tissue specificity

    Highest expression in heart, brain, and spinal cord.
  • Sequence similarities

    Belongs to the dickkopf family.
  • Domain

    The C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6.
  • Post-translational
    modifications

    N- and O-glycosylated.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • DTT-reduced SDS-PAGE analysis of ab207108 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 55-66 kDa in SDS-PAGE due to glycosylation.

References

ab207108 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207108.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up