Description

  • Product name

    Recombinant Mouse DOCK8 protein (His tag)
    See all DOCK8 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      RNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSGPE FLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQG ASGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQN PPIKWAEGHKGVFNIEVQAV
    • Predicted molecular weight

      21 kDa including tags
    • Amino acids

      561 to 730
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab241267 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • 1200017A24Rik
    • Dedicator of cytokinesis protein 8
    • DOCK8
    • DOCK8_HUMAN
    • Epididymis luminal protein 205
    • HEL 205
    • MRD2
    • ZIR8
    see all
  • Function

    Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP.
  • Involvement in disease

    Defects in DOCK8 are the cause of hyperimmunoglobulin E recurrent infection syndrome autosomal recessive (AR-HIES) [MIM:243700]. It is a rare disorder of immunity characterized by immunodeficiency, recurrent infections, eczema, increased serum IgE, eosinophilia and lack of connective tissue and skeletal involvement.
  • Sequence similarities

    Belongs to the DOCK family.
    Contains 1 DHR-1 (CZH-1) domain.
    Contains 1 DHR-2 (CZH-2) domain.
  • Domain

    The DHR-2 domain may mediate some GEF activity.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab241267.

References

ab241267 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab241267.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up