Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MKKIDDDKNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRC QTRDLEWWELR
    • Molecular weight

      7 kDa
    • Amino acids

      975 to 1029
    • Additional sequence information

      Non-glycosylated protein.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab218147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The activity is determined by the dose-dependent proliferation of mouse BALB/c 3T3 cells and is  typically less than 0.1 ng/mL. This corresponds to an expected specific activity of 1 x 107 units/mg. There is no significant decrease in biological activity for the biotin conjugate when compared to standard recombinant mouse EGF. There are 0.5 biotins for each EGF protein. 

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    As determined by reducing and non-reducing SDS-PAGE.
  • Form

    Liquid
  • Additional notes

    Do not vortex.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Beta urogastrone
    • beta-urogastrone
    • EGF
    • EGF_HUMAN
    • Epidermal growth factor
    • HOMG4
    • OTTHUMP00000219721
    • OTTHUMP00000219722
    • Pro epidermal growth factor
    • URG
    • Urogastrone
    see all
  • Function

    EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro (PubMed:10964941).
  • Tissue specificity

    Expressed in kidney, salivary gland, cerebrum and prostate.
  • Involvement in disease

    Hypomagnesemia 4
  • Sequence similarities

    Contains 9 EGF-like domains.
    Contains 9 LDL-receptor class B repeats.
  • Post-translational
    modifications

    O-glycosylated with core 1-like and core 2-like glycans. It is uncertain if Ser-954 or Thr-955 is O-glycosylated. The modification here shows glycan heterogeneity: HexHexNAc (major) and Hex2HexNAc2 (minor).
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Bioassay showing EGF-Biotin conjugate induced proliferation of 3T3 cells using ab218147.

References

ab218147 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up