Description

  • Product name

    Recombinant Mouse ENO1 protein (His tag)
    See all ENO1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      SILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRD NDKTRFMGKGVSQAVEHINKTIAPALVSKKVNVVEQEKIDKLMIEMDGTE NKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNPEVILPVPAFN VINGGSHAGNKLAMQEFMILPVGASSFREAMRIGAEVYHNLKNVIKEKYG KDATNVGDEGGFAPNILENKEALELLKTAIAKAGYTDQVVIGMDVAASEF YRSGKYDLDFKSPDDPSRYITPDQLADLYKSFVQNYPVVSIEDPFDQDDW GAWQKFTASAGIQVVGDDLTVTNPKRIAKAASEKSCNCLLLKVNQIGSVT ESLQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRS ERLAKYNQILRIEEELGSKAKFAGRSFRNPLA
    • Predicted molecular weight

      50 kDa including tags
    • Amino acids

      2 to 433
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab235075 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • 2 phospho D glycerate hydro lyase
    • 2-phospho-D-glycerate hydro-lyase
    • Alpha enolase
    • Alpha enolase like 1
    • Alpha-enolase
    • C myc promoter binding protein
    • C-myc promoter-binding protein
    • EC 4.2.1.11
    • eno1
    • ENO1L1
    • ENOA_HUMAN
    • Enolase 1
    • Enolase 1 (alpha)
    • Enolase 1 (alpha) like 1
    • Enolase alpha
    • MBP 1
    • MBP-1
    • MBP1
    • MBPB1
    • MPB 1
    • MPB-1
    • MPB1
    • MYC promoter binding protein 1
    • NNE
    • Non neural enolase
    • Non-neural enolase
    • Phosphopyruvate hydratase
    • Plasminogen binding protein
    • Plasminogen-binding protein
    • PPH
    • Tau crystallin
    see all
  • Function

    Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production.
    MBP1 binds to the myc promoter and acts as a transcriptional repressor. May be a tumor suppressor.
  • Tissue specificity

    The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
  • Pathway

    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 4/5.
  • Sequence similarities

    Belongs to the enolase family.
  • Developmental stage

    During ontogenesis, there is a transition from the alpha/alpha homodimer to the alpha/beta heterodimer in striated muscle cells, and to the alpha/gamma heterodimer in nerve cells.
  • Post-translational
    modifications

    ISGylated.
  • Cellular localization

    Nucleus and Cytoplasm. Cell membrane. Cytoplasm > myofibril > sarcomere > M line. Can translocate to the plasma membrane in either the homodimeric (alpha/alpha) or heterodimeric (alpha/gamma) form. ENO1 is localized to the M line.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel of ab235075 

References

ab235075 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235075.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up