Description

  • Product name

    Recombinant Mouse Entactin/NID protein
    See all Entactin/NID proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      SPQRVNGKVKGRIFVGSSQVPVVFENTDLHSYVVMNHGRSYTAISTIPET VGYSLLPLAPIGGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFLGHPG KLVLKQQFSGIDEHGHLTISTELEGRVPQIPYGASVHIEPYTELYHYSSS VITSSSTREYTVMEPDQDGAAPSHTHIYQWRQTITFQECAHDDARPALPS TQQLSVDSVFVLYNKEERILRYALSNSIGPVRDGSPDA
    • Predicted molecular weight

      26 kDa
    • Amino acids

      428 to 665

Specifications

Our Abpromise guarantee covers the use of ab225643 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Entactin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Enactin
    • Ent
    • Entactin
    • Entactin 1
    • NID
    • NID 1
    • NID-1
    • Nid1
    • NID1_HUMAN
    • Nidogen
    • Nidogen (enactin)
    • Nidogen 1
    • Nidogen-1
    see all
  • Function

    Sulfated glycoprotein widely distributed in basement membranes and tightly associated with laminin. Also binds to collagen IV and perlecan. It probably has a role in cell-extracellular matrix interactions.
  • Sequence similarities

    Contains 6 EGF-like domains.
    Contains 4 LDL-receptor class B repeats.
    Contains 1 NIDO domain.
    Contains 1 nidogen G2 beta-barrel domain.
    Contains 1 thyroglobulin type-1 domain.
  • Post-translational
    modifications

    N- and O-glycosylated.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix > basement membrane.
  • Information by UniProt

References

ab225643 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225643.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up