Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEIC ADPKKKWVQDATKHLDQKLQTPKP
    • Molecular weight

      8 kDa
    • Amino acids

      24 to 97
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included. A single non-glycosylated polypeptide chain.

Specifications

Our Abpromise guarantee covers the use of ab201417 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 100-1000 ng/ml.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Purity

    > 96 % SDS-PAGE.
    > 96 % by HPLC analysis
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • C-C motif chemokine 11
    • CCL 11
    • CCL11
    • CCL11_HUMAN
    • chemokine (C-C motif) ligand 11
    • Chemokine C C motif ligand 11
    • Chemokine CC Motif Ligand 11
    • Chemokine ligand 11
    • Eosinophil chemotactic protein
    • Eotaxin
    • eotaxin-1
    • MGC22554
    • SCYA 11
    • SCYA11
    • Small inducible cytokine A11
    • Small inducible cytokine subfamily A (Cys Cys) member 11
    • small inducible cytokine subfamily A (Cys-Cys), member 11 (eotaxin)
    • Small inducible cytokine subfamily A member 11
    • Small-inducible cytokine A11
    see all
  • Function

    In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    O-linked glycan consists of a Gal-GalNAc disaccharide which is mofified with up to 2 sialic acid residues.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab201417 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201417.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up