Description

  • Product name

    Recombinant Mouse Eph receptor B4/HTK protein
    See all Eph receptor B4/HTK proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    ab222345 was purified by conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      LEETLLNTKLETADLKWVTYPQAEGQWEELSGLDEEQHSVRTYEVCDMKR PGGQAHWLRTGWVPRRGAVHVYATIRFTMMECLSLPRASRSCKETFTVFY YESEADTATAHTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNIKTLR LGPLSKAGFYLAFQDQGACMALLSLHLFYKKCSWLITNLTYFPETVPREL VVPVAGSCVANAVPTANPSPSLYCREDGQWAEQQVTGCSCAPGYEAAESN KVCRACGQGTFKPQIGDESCLPCPANSHSNNIGSPVCLCRIGYYRARSDP RSSPCTTPPSAPRSVVHHLNGSTLRLEWSAPLESGGREDLTYAVRCRECR PGGSCLPCGGDMTFDPGPRDLVEPWVAIRGLRPDVTYTFEVAALNGVSTL ATGPPPFEPVNVTTDREVPPAVSDIRVTRSSPSSLILSWAIPRAPSGAVL DYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGY GPFGQEHHSQTQLDESESWREQLAVEHHHHHH
    • Predicted molecular weight

      59 kDa including tags
    • Amino acids

      16 to 540
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab222345 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Eph receptor B4

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: PBS, 10% Glycerol

General Info

  • Alternative names

    • Ephb4
    • EPHB4_HUMAN
    • Ephrin receptor EphB4
    • Ephrin type-B receptor 4
    • Hepatoma Transmembrane Kinase
    • HTK
    • MYK 1
    • MYK1
    • TYRO 11
    • TYRO11
    • Tyrosine-protein kinase receptor HTK
    • Tyrosine-protein kinase TYRO11
    see all
  • Function

    Receptor for members of the ephrin-B family. Binds to ephrin-B2. May have a role in events mediating differentiation and development.
  • Tissue specificity

    Abundantly expressed in placenta and in a range of primary tissues and malignant cell lines. Expressed in fetal, but not adult, brain, and in primitive and myeloid, but not lymphoid, hematopoietic cells.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 protein kinase domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Post-translational
    modifications

    Autophosphorylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE - Recombinant Mouse Eph receptor B4/HTK protein (ab222345 at 3 µg)

References

ab222345 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222345.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up