Description

  • Product name

    Recombinant Mouse Ephrin A4 protein
    See all Ephrin A4 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      RHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPHYESPGPPEGPETFALY MVDWSGYEACTAEGA NAFQRWNCSMPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTP ESPGRCLRLQVSVCC KESGSSHESAHPVGSPGESGVDDIEGRMDEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT CLVKGFYPSDIAVEW ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEA LHNHYTQKSLSLSPG K
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      27 to 176
    • Additional sequence information

      This product is for the mature full length protein with a Fc tag at C terminus. The signal peptide and propeptide are not included.

Specifications

Our Abpromise guarantee covers the use of ab191954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
    Aliquots of reconstituted samples are stable at < -20°C for 3 months.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • EFL 4
    • EFL4
    • EFN A4
    • EFNA 4
    • EFNA4
    • EFNA4_HUMAN
    • Eph related receptor tyrosine kinase ligand 4
    • EPH-related receptor tyrosine kinase ligand 4
    • Ephrin-A4
    • EphrinA4
    • EPLG 4
    • EPLG4
    • LERK 4
    • LERK-4
    • LERK4
    • Ligand of Eph related kinase 4
    • MGC125826
    see all
  • Function

    May play a role in the interaction between activated B lymphocytes and dendritic cells in tonsils.
  • Tissue specificity

    Expressed in the adult spleen, lymph node, prostate, ovary, small intestine, and colon, and in fetal heart, lung, liver and kidney. Also detected in hematopoietic cell lines.
  • Sequence similarities

    Belongs to the ephrin family.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

References

ab191954 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up