Description

  • Product name

    Recombinant mouse EPO protein (Fc Chimera)
    See all EPO proteins and peptides
  • Biological activity

    ED50 < 5 ng/ml as determined in a cell proliferation assay using Human TF-1 erythroleukemia cells.

  • Purity

    > 95 % SDS-PAGE.
    ab170076 is purified by chromatography, sterile filtered and lyophilized.
  • Expression system

    Insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      APPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYA WKRMEVEEQAIEVWQGLSLLSEAILQAQALLANSSQPPETLQLHIDKAIS GLRSLTSLLRVLGAQKELMSPPDTTPPAPLRTLTVDTFCKLFRVYANFLR GKLKLYTGEVCRRGDR
    • Predicted molecular weight

      49 kDa
    • Amino acids

      27 to 192

Specifications

Our Abpromise guarantee covers the use of ab170076 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    Constituent: 100% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Add 0.5ml deionized water. Aliquot and freeze unused portion.

General Info

  • Alternative names

    • EP
    • EPO
    • EPO alpha
    • Epoetin
    • Erythropoetin
    • Erythropoietin precursor
    • MVCD2
    see all
  • Relevance

    Human erythropoietin is member of the EPO/TPO family and encodes a secreted, glycosylated cytokine hormone composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. It is produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
  • Cellular localization

    Secreted

Images

  • SDS-PAGE analysis of ab170076.

    Lane 1: 3µg ab170076 Reduced
    Lane 2: 3µg ab170076 Non-reduced
    Lane 3: Molecular weight markers

  • Proliferation of Human TF-1 erythroleukemia cells by ab170076.

References

ab170076 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170076.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up