Description

  • Product name

    Recombinant mouse Exodus 2 protein
  • Biological activity

    Fully biologically active when compared to standard.

    Determined by its ability to chemoattract total murine T cell population using a concentration range of 10.0 -100.0 ng/ml.

  • Purity

    > 97 % SDS-PAGE.
    > 97 % by HPLC analysis.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPE LCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCK RTEQTQPSRG
    • Predicted molecular weight

      12 kDa
    • Amino acids

      24 to 133
    • Additional sequence information

      Single, non-glycosylated polypeptide chain containing 110 amino acids. This product is the mature full length protein from aa 24 to 133. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab201361 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

    Lyophilized from a 0.2µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • 6Ckine
    • Beta chemokine exodus-2
    • Beta-chemokine exodus-2
    • C-C motif chemokine 21
    • CCL 21
    • CCL21
    • CCL21_HUMAN
    • Chemokine (C-C motif) ligand 21
    • CKb 9
    • CKb9
    • ECL
    • Efficient Chemoattractant for Lymphocytes
    • Exodus2
    • MGC34555
    • OTTHUMP00000000526
    • OTTHUMP00000000527
    • SCYA 21
    • SCYA21
    • Secondary lymphoid tissue chemokine
    • Secondary lymphoid-tissue chemokine
    • SLC
    • Small inducible cytokine A21
    • Small inducible cytokine subfamily A (Cys-Cys) member 21
    • Small-inducible cytokine A21
    • TCA 4
    • TCA4
    see all
  • Function

    Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs.
  • Tissue specificity

    Highly expressed in high endothelial venules of lymph nodes, spleen and appendix. Intermediate levels found in small intestine, thyroid gland and trachea. Low level expression in thymus, bone marrow, liver, and pancreas. Also found in tonsil, fetal heart and fetal spleen.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab201361 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201361.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up