For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-mouse-factor-xii-protein-ab170085.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Blood Coagulation Intrinsic
Share by email

Recombinant Mouse Factor XII protein (ab170085)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Mouse Factor XII protein (ab170085)

    Key features and details

    • Expression system: Insect cells
    • Purity: > 95% SDS-PAGE
    • Suitable for: SDS-PAGE

    You may also be interested in

    ELISA
    Product image
    Mouse FXII ELISA kit (total FXII antigen) (ab272776)

    View more associated products

    Description

    • Product name

      Recombinant Mouse Factor XII protein
      See all Factor XII proteins and peptides
    • Purity

      > 95 % SDS-PAGE.
      ab170085 was purified by ion exchange chromatography.
    • Expression system

      Insect cells
    • Accession

      Q80YC5
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Mouse
      • Sequence

        MTALLFLGSLLMSLDLTLSAPPWKDSKKFKDAPDGPTVVLTVDGRLCHFP FQYHRQLHHKCIHKRRPGSRPWCATTPNFDEDQQWGYCLEPKKVKDHCSK HNPCHKGGTCINTPNGPHCLCPEHLTGKHCQKEKCFEPQLLKFFHENELW FRTGPGGVARCECKGSEAHCKPVASQACSINPCLNGGSCLLVEDHPLCRC PTGYTGYFCDLDLWATCYEGRGLSYRGQAGTTQSGAPCQRWTVEATYRNM TEKQALSWGLGHHAFCRNPDNDTRPWCFVWSGDRLSWDYCGLEQCQTPTF APLVVPESQEESPSQAPSLSHAPNDSTDHQTSLSKTNTMGCGQRFRKGLS SFMRVVGGLVALPGSHPYIAALYWGNNFCAGSLIAPCWVLTAAHCLQNRP APEELTVVLGQDRHNQSCEWCQTLAVRSYRLHEGFSSITYQHDLALLRLQ ESKTNSCAILSPHVQPVCLPSGAAPPSETVLCEVAGWGHQFEGAEEYSTF LQEAQVPFIALDRCSNSNVHGDAILPGMLCAGFLEGGTDACQGDSGGPLV CEEGTAEHQLTLRGVISWGSGCGDRNKPGVYTDVANYLAWIQKHIAS
      • Predicted molecular weight

        75 kDa
      • Amino acids

        1 to 597

    Associated products

      Specifications

      Our Abpromise guarantee covers the use of ab170085 in the following tested applications.

      The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

      • Applications

        SDS-PAGE

      • Form

        Liquid
      • Concentration information loading...

      Preparation and Storage

      • Stability and Storage

        Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

        pH: 5.30
        Constituents: 0.03% Sodium acetate, 0.88% Sodium chloride

      General Info

      • Alternative names

        • Factor XII
        • Beta factor XIIa part 1
        • Beta factor XIIa part 2
        • Coagulation factor XII
        • Coagulation factor XIIa heavy chain
        • Coagulation factor XIIa light chain
        • F12
        • F12 deficiency
        • FA12_HUMAN
        • Factor XII deficiency
        • HAE3
        • HAEX
        • HAF
        • HAF deficiency
        • Hageman factor
        see all
      • Function

        Factor XII is a serum glycoprotein that participates in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. Prekallikrein is cleaved by factor XII to form kallikrein, which then cleaves factor XII first to alpha-factor XIIa and then trypsin cleaves it to beta-factor XIIa. Alpha-factor XIIa activates factor XI to factor XIa.
      • Involvement in disease

        Defects in F12 are the cause of factor XII deficiency (FA12D) [MIM:234000]; also known as Hageman factor deficiency. This trait is an asymptomatic anomaly of in vitro blood coagulation. Its diagnosis is based on finding a low plasma activity of the factor in coagulating assays. It is usually only accidentally discovered through pre-operative blood tests. F12 deficiency is divided into two categories, a cross-reacting material (CRM)-negative group (negative F12 antigen detection) and a CRM-positive group (positive F12 antigen detection).
        Defects in F12 are the cause of hereditary angioedema type 3 (HAE3) [MIM:610618]; also known as estrogen-related HAE or hereditary angioneurotic edema with normal C1 inhibitor concentration and function. HAE is characterized by episodic local subcutaneous edema, and submucosal edema involving the upper respiratory and gastrointestinal tracts. HAE3 occurs exclusively in women and is precipitated or worsened by high estrogen levels (e.g., during pregnancy or treatment with oral contraceptives). It differs from HAE types 1 and 2 in that both concentration and function of C1 inhibitor are normal.
      • Sequence similarities

        Belongs to the peptidase S1 family.
        Contains 2 EGF-like domains.
        Contains 1 fibronectin type-I domain.
        Contains 1 fibronectin type-II domain.
        Contains 1 kringle domain.
        Contains 1 peptidase S1 domain.
      • Post-translational
        modifications

        Factor XII is activated by kallikrein in alpha-factor XIIa, which is then further converted by trypsin into beta-factor XIIa. Alpha-factor XIIa is composed of the NH2-terminal heavy chain (Coagulation factor XIIa heavy chain) and the COOH-terminal light chain (Coagulation factor XIIa light chain), connected by a disulfide bond. Beta-factor XIIa is composed of 2 chains linked by a disulfide bond, a light chain (Beta-factor XIIa part 2), corresponding to the COOH-terminal light chain (Coagulation factor XIIa light chain) and a nonapeptide (Beta-factor XIIa part 1).
        O- and N-glycosylated. The O-linked polysaccharides were not identified, but are probably the mucin type linked to GalNAc.
      • Cellular localization

        Secreted.
      • Target information above from: UniProt accession P00748 The UniProt Consortium
        The Universal Protein Resource (UniProt) in 2010
        Nucleic Acids Res. 38:D142-D148 (2010) .

        Information by UniProt

      Images

      • SDS-PAGE - Recombinant Mouse Factor XII protein (ab170085)
        SDS-PAGE - Recombinant Mouse Factor XII protein (ab170085)
        SDS-PAGE analysis of ab170085.

        Lane 1: 3 µg ab170085 reduced
        Lane 2: Molecular weight markers

      Protocols

      To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

      Click here to view the general protocols

      Datasheets and documents

      • Datasheet
    • References (0)

      Publishing research using ab170085? Please let us know so that we can cite the reference in this datasheet.

      ab170085 has not yet been referenced specifically in any publications.

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      There are currently no Customer reviews or Questions for ab170085.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.