Description

  • Product name

    Recombinant Mouse Fas protein (His tag)
    See all Fas proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKM NGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNT KCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRHH HHHH
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      22 to 169
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab215626 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µm filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Dissolve the lyophilized protein in ddH2O. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Do not mix by vortex or pipetting.

General Info

  • Alternative names

    • ALPS 1A
    • ALPS1A
    • APO 1
    • Apo 1 antigen
    • APO 1 cell surface antigen
    • Apo-1 antigen
    • APO1
    • Apo1 antigen
    • APO1 cell surface antigen
    • Apoptosis antigen 1
    • Apoptosis mediating surface antigen FAS
    • Apoptosis-mediating surface antigen FAS
    • APT 1
    • APT1
    • CD 95
    • CD 95 antigen
    • CD95
    • CD95 antigen
    • Delta Fas
    • Delta Fas/APO 1/CD95
    • Delta Fas/APO1/CD95
    • Fas
    • Fas (TNF receptor superfamily, member 6)
    • FAS 1
    • FAS 827dupA
    • Fas AMA
    • FAS Antigen
    • Fas cell surface death receptor
    • FAS1
    • FASLG receptor
    • FASTM
    • sFAS
    • Surface antigen APO1
    • TNF receptor superfamily, member 6
    • TNFRSF 6
    • TNFRSF6
    • TNR6_HUMAN
    • Tumor necrosis factor receptor superfamily member 6
    see all
  • Function

    Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro).
  • Tissue specificity

    Isoform 1 and isoform 6 are expressed at equal levels in resting peripheral blood mononuclear cells. After activation there is an increase in isoform 1 and decrease in the levels of isoform 6.
  • Involvement in disease

    Defects in FAS are the cause of autoimmune lymphoproliferative syndrome type 1A (ALPS1A) [MIM:601859]; also known as Canale-Smith syndrome (CSS). ALPS is a childhood syndrome involving hemolytic anemia and thrombocytopenia with massive lymphadenopathy and splenomegaly.
  • Sequence similarities

    Contains 1 death domain.
    Contains 3 TNFR-Cys repeats.
  • Domain

    Contains a death domain involved in the binding of FADD, and maybe to other cytosolic adapter proteins.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

References

ab215626 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215626.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up