Recombinant Mouse Fc epsilon RI/FCER1A protein (Tagged) (ab235018)

Description

  • Product name

    Recombinant Mouse Fc epsilon RI/FCER1A protein (Tagged)
    See all Fc epsilon RI/FCER1A proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Cell free
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVN SSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLV HGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYH CKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLL STEEQFKSVLEIQKTGKYKKVETELLT
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      24 to 250
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full length mature chain without signal peptide. N-terminal 10xHis-SUMO-tagged. In vitro E.coli expression system.

Specifications

Our Abpromise guarantee covers the use of ab235018 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Fc epsilon RI

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Fc epsilon RI alpha
    • Fc epsilon RI alpha chain
    • Fc epsilon RI alpha-chain
    • Fc fragment of IgE high affinity I receptor for alpha polypeptide
    • Fc fragment of IgE, high affinity I, receptor for, alpha subunit
    • Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
    • Fc IgE receptor alpha polypeptide
    • Fc IgE receptor, alpha chain
    • Fc IgE receptor, alpha polypeptide
    • Fc of IgE high affinity I receptor for alpha polypeptide
    • Fc-epsilon RI-alpha
    • FCE 1A
    • FCE1A
    • FCER 1A
    • Fcer1a
    • FCERA_HUMAN
    • FcERI
    • FceRI alpha
    • high affinity IgE receptor
    • High affinity immunoglobulin epsilon receptor alpha subunit
    • high affinity immunoglobulin epsilon receptor alpha-subunit
    • High affinity immunoglobulin epsilon receptor subunit alpha
    • IgE Fc receptor alpha subunit
    • IgE Fc receptor subunit alpha
    • Immunoglobulin E receptor high affinity of mast cells alpha polypeptide
    • immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide
    see all
  • Function

    Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
  • Sequence similarities

    Contains 2 Ig-like (immunoglobulin-like) domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab235018 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235018 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235018.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up