Recombinant Mouse Fc receptor, IgG, low affinity IV protein (His tag) (ab217566)

Description

  • Product name

    Recombinant Mouse Fc receptor, IgG, low affinity IV protein (His tag)
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      GLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQD ANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEG DPIHLRCHSWQNRPVRKVTYSQNGKGKKYFHENSELLIPKATHNDSGSYF CRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQVDHHHHHH
    • Predicted molecular weight

      22 kDa including tags
    • Amino acids

      21 to 203
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab217566 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µm filtered solution.

  • Reconstitution
    Dissolve the lyophilized protein in ddH2O. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Always centrifuge tubes before opening. Do not mix by vortex or pipetting.

General Info

  • Alternative names

    • 4833442P21Rik
    • CD16-2
    • Fc fragment of IgG, low affinity III, receptor for (CD16)
    • Fc receptor like 3
    • FcgammaRIV
    • Fcgr3a
    • FcgRIV
    • Fcrl3
    see all

References

ab217566 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217566.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up