Description

  • Product name

    Recombinant Mouse FCP1 protein (Tagged)
    See all FCP1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRP HCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDEC IDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTG DVNAPPAARETQAR
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      178 to 341
    • Additional sequence information

      N-terminal 10xHis-tagged and C-terminal Myc-tagged.

Specifications

Our Abpromise guarantee covers the use of ab238285 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • CCFDN
    • CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase, subunit 1
    • CTD of POLR2A, phosphatase of, subunit 1
    • CTDP1
    • CTDP1_HUMAN
    • EC 3.1.3.16
    • RNA polymerase II subunit A C terminal domain phosphatase
    • RNA polymerase II subunit A C-terminal domain phosphatase
    • Serine phosphatase FCP1a
    • TFIIF associating CTD phosphatase
    • TFIIF-associating CTD phosphatase
    • TFIIF-associating CTD phosphatase 1
    • Transcription factor IIF-associating CTD phosphatase 1
    see all
  • Function

    Processively dephosphorylates 'Ser-2' and 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit. This promotes the activity of RNA polymerase II.
  • Tissue specificity

    Ubiquitously expressed. Isoform 3 is expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and placenta.
  • Involvement in disease

    Defects in CTDP1 are a cause of congenital cataracts facial dysmorphism and neuropathy syndrome (CCFDN) [MIM:604168]. CCFDN is an autosomal recessive developmental disorder that occurs in an endogamous group of Vlax Roma (Gypsies). The syndrome is characterized by a complex clinical phenotype with seemingly unrelated features involving multiple organs and systems. Developmental abnormalities include congenital cataracts and microcorneae, hypomyelination of the peripheral nervous system, impaired physical growth, delayed early motor and intellectual development, facial dysmorphism and hypogonadism. Central nervous system involvement, with cerebral and spinal cord atrophy, may be the result of disrupted development with superimposed degenerative changes. Affected individuals are prone to severe rhabdomyolysis after viral infections and to serious complications related to general anesthesia (such as pulmonary edema and epileptic seizures).
  • Sequence similarities

    Contains 1 BRCT domain.
    Contains 1 FCP1 homology domain.
  • Post-translational
    modifications

    Phosphorylated. In the presence of TFIIF, the phosphorylated form has an increased CTD phosphatase activity. The phosphorylation is required for the physical interaction with GTF2F1.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab238285 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab238285 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238285.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up