Description

  • Product name

    Recombinant Mouse FGF-15 protein
    See all FGF-15 proteins and peptides
  • Purity

    > 90 % Densitometry.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MKHHHHHHASRPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNC FLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGK IYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQK PSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPS FQK
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      26 to 218
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 26 to 218. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab206457 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.29% Sodium chloride, 0.02% DTT, 0.24% Tris

    Lyophilized from a 0.4 µm filtered solution.

General Info

  • Alternative names

    • FGF-15
    • Fgf15
    • FGF15_MOUSE
    • FGF19
    • Fibroblast growth factor 15
    see all
  • Function

    Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression.
  • Tissue specificity

    Expressed in the developing brain.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 14% SDS-PAGE analysis of ab206457.
    Lane 1: Reduced and boiled sample, 5μg/lane
    Lane 2: Non-reduced and non-boiled sample, 5μg/lane

References

ab206457 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206457.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up