Description

  • Product name

    Recombinant Mouse FGF17 protein (His tag)
    See all FGF17 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Lyophilized from a 0.2 µm filtered solution.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGR RISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPS GKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQRE AHFIKRLYQGQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQTLEHHH HHH
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      23 to 216
    • Tags

      His tag C-Terminus
    • Additional sequence information

      ab215628 is the mature full length protein without the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab215628 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term.

    pH: 7.4
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    Also contains EDTA and DTT.

  • Reconstitution
    Reconstitute with ddH2O to a concentration no less than 100 µg/mL. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • FGF 13
    • FGF 17
    • FGF-17
    • FGF13
    • Fgf17
    • FGF17_HUMAN
    • Fibroblast growth factor 17
    • HH20
    see all
  • Function

    Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development.
  • Tissue specificity

    Preferentially expressed in the embryonic brain.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Developmental stage

    Detected in embryos at E14.5, but not at E10.5 and E19.5. Preferentially expressed in the neuroepithelia of the isthmus and septum of the embryonic brain at E14.5.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab215628 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215628.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up