Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVK LQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNN YNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
    • Amino acids

      11 to 154

Specifications

Our Abpromise guarantee covers the use of ab129033 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The activity was determined by the stimulation of HUVE cells. The ED50 for this effect is = 0.1ng/ml corresponding to a specific activity of = 1 x 107 units/mg.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    Constituent: 99% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    ab129033 can be reconstituted with ddH2O or 50 mM acedic acid at 50 µg/mL. This solution can be diluted into other buffered solutions or stored frozen for future use. Avoid repeated freeze-thaw cycles.

General Info

  • Alternative names

    • Basic fibroblast growth factor
    • Basic fibroblast growth factor bFGF
    • BFGF
    • FGF 2
    • FGF B
    • FGF-2
    • Fgf2
    • FGF2 basic
    • FGF2_HUMAN
    • FGFB
    • Fibroblast growth factor 2
    • Fibroblast growth factor 2 (basic)
    • Fibroblast growth factor, basic
    • HBGF 2
    • HBGF-2
    • HBGF2
    • HBGH 2
    • HBGH2
    • Heparin binding growth factor 2 precursor
    • Heparin-binding growth factor 2
    • Prostatropin
    see all
  • Function

    Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis (PubMed:23469107).
  • Tissue specificity

    Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Post-translational
    modifications

    Phosphorylation at Tyr-215 regulates FGF2 unconventional secretion.
    Several N-termini starting at positions 94, 125, 126, 132, 143 and 162 have been identified by direct sequencing.
  • Cellular localization

    Secreted. Nucleus. Exported from cells by an endoplasmic reticulum (ER)/Golgi-independent mechanism. Unconventional secretion of FGF2 occurs by direct translocation across the plasma membrane. Binding of exogenous FGF2 to FGFR facilitates endocytosis followed by translocation of FGF2 across endosomal membrane into the cytosol. Nuclear import from the cytosol requires the classical nuclear import machinery, involving proteins KPNA1 and KPNB1, as well as CEP57.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab129033 with subsequent Silver staining.
  • Dose-dependent stimulation of cell proliferation in HUVE cells by recombinant rat FGF2 and ab129033 (mFGF2). Values are the means (±SD) of triplicate determinations and expressed as percentage of control.

References

ab129033 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Vielen Dank für Ihre Anfrage.

Leider haben wir nicht das passende Blockpeptid für den ab106245 Anti-FGF2 antibody in unserem Katalog, dafür aber das aktive, rekommbinate Protein ab129033:

Click here (or use the following: https://www.abcam.com/index.html?datasheet=129033).

Für den ab71395 Anti-FGF9 antibody haben wir so wohl das korrespondierende Blockpeptid ab86940 Click here (or use the following: https://www.abcam.com/index.html?datasheet=86940) als auch das Protein, in der aktiven (ab78476) oder inaktiven (ab9745) Form:

Click here (or use the following: https://www.abcam.com/index.html?datasheet=9745).

Click here (or use the following: https://www.abcam.com/index.html?datasheet=78476).


Ich hoffe, dies hilft Ihnen weiter. Bitte zögern Sie nicht, sich wieder bei uns zu melden, falls Sie weitere Fragen haben.

Benutzen Sie unsere Produkte? Schicken Sie uns einen Abreview. Verdienen Sie sich eine Belohnung!
https://www.abcam.com/abreviews

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up