Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH VKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLES NNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
    • Molecular weight

      17 kDa
    • Amino acids

      10 to 154
    • Additional sequence information

      This product is the mature full length protein from aa 10 to 154. The propeptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab229521 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    3T3 cell proliferation.

    ≤ED50 ≤ 2.5 ng/ml (≥ 4.0 x 105 units/mg).

    (typical ED50 is < 0.5 ng/ml).

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    <=1.000 Eu/µg
  • Purity

    >= 95 % SDS-PAGE.
    Purity determined by reducing and non-reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.16% Sodium phosphate, 0.29% Sodium chloride

    Lyophilized from a sterile (0.2 micron) filtered aqueous solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile water at 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • Basic fibroblast growth factor
    • Basic fibroblast growth factor bFGF
    • BFGF
    • FGF 2
    • FGF B
    • FGF-2
    • Fgf2
    • FGF2 basic
    • FGF2_HUMAN
    • FGFB
    • Fibroblast growth factor 2
    • Fibroblast growth factor 2 (basic)
    • Fibroblast growth factor, basic
    • HBGF 2
    • HBGF-2
    • HBGF2
    • HBGH 2
    • HBGH2
    • Heparin binding growth factor 2 precursor
    • Heparin-binding growth factor 2
    • Prostatropin
    see all
  • Function

    Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis (PubMed:23469107).
  • Tissue specificity

    Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Post-translational
    modifications

    Phosphorylation at Tyr-215 regulates FGF2 unconventional secretion.
    Several N-termini starting at positions 94, 125, 126, 132, 143 and 162 have been identified by direct sequencing.
  • Cellular localization

    Secreted. Nucleus. Exported from cells by an endoplasmic reticulum (ER)/Golgi-independent mechanism. Unconventional secretion of FGF2 occurs by direct translocation across the plasma membrane. Binding of exogenous FGF2 to FGFR facilitates endocytosis followed by translocation of FGF2 across endosomal membrane into the cytosol. Nuclear import from the cytosol requires the classical nuclear import machinery, involving proteins KPNA1 and KPNB1, as well as CEP57.
  • Information by UniProt

Images

  • ab229521 induced proliferation of 3T3 cells.

  • 1 µg ab229521 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

References

ab229521 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229521.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up