Description

  • Product name

    Recombinant Mouse FKBP12 protein
    See all FKBP12 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab201895 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMGVQVETISPGDGRTFPKRGQTCVVH YTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKLI ISSDYAYGATGHPGIIPPHATLVFDVELLKLE
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      1 to 108
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_032045.

Specifications

Our Abpromise guarantee covers the use of ab201895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 79% PBS, 0.02% DTT, 20% Glycerol

General Info

  • Alternative names

    • 12 kDa FK506-binding protein
    • 12 kDa FKBP
    • Calstabin 1
    • FK506 binding protein 1
    • FK506 binding protein 12
    • FK506 binding protein 1A
    • FK506 binding protein 1A (12kD)
    • FK506 binding protein 1A 12kDa
    • FK506 binding protein T cell 12 kD
    • FK506 binding protein, T cell, 12 kD
    • FK506 binding protein12
    • FK506-binding protein 1A
    • FKB1A_HUMAN
    • FKBP 12
    • FKBP 1A
    • FKBP-12
    • FKBP-1A
    • FKBP1
    • FKBP12
    • FKBP12 Exip3
    • FKBP12C
    • fkbp1a
    • Immunophilin FKBP12
    • Peptidyl prolyl cis trans isomerase
    • Peptidyl-prolyl cis-trans isomerase FKBP1A
    • PKC12
    • PKCI2
    • PPIase
    • PPIase FKBP1A
    • Protein kinase C inhibitor 2
    • Rotamase
    see all
  • Function

    May play a role in modulation of ryanodine receptor isoform-1 (RYR-1), a component of the calcium release channel of skeletal muscle sarcoplasmic reticulum. There are four molecules of FKBP12 per skeletal muscle RYR. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Sequence similarities

    Belongs to the FKBP-type PPIase family. FKBP1 subfamily.
    Contains 1 PPIase FKBP-type domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab201895 (3μg).

References

ab201895 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up