Description

  • Product name

    Recombinant Mouse FUCA1 protein (Tagged)
    See all FUCA1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      LAPRRFTPDWQSLDSRPLPSWFDEAKFGVFVHWGVFSVPAWGSEWFWWHW QGDRMPAYQRFMTENYPPGFSYADFAPQFTARFFHPDQWAELFQAAGAKY VVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGAAVRKRNIRYGL YHSLLEWFHPLYLLDKKNGFKTQHFVRAKTMPELYDLVNSYKPDLIWSDG EWECPDTYWNSTSFLAWLYNDSPVKDEVIVNDRWGQNCSCHHGGYYNCQD KYKPQSLPDHKWEMCTSMDRASWGYRKDMTMSTIAKENEIIEELVQTVSL GGNYLLNIGPTKDGLIVPIFQERLLAVGKWLQINGEAIYASKPWRVQSEK NKTVVWYTTKNATVYATFLYWPENGIVNLKSPKTTSATKITMLGLEGDLS WTQDPLEGVLISLPQLPPTVLPVEFAWTLKLTKVN
    • Predicted molecular weight

      67 kDa including tags
    • Amino acids

      18 to 452
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full length mature chain without signal peptide. N-terminal 6xHis-SUMO-tagged.

Specifications

Our Abpromise guarantee covers the use of ab226241 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Alpha L fucosidase I
    • Alpha L fucoside fucohydrolase
    • Alpha-L-fucosidase 1
    • Alpha-L-fucosidase I
    • Alpha-L-fucoside fucohydrolase 1
    • FUCA
    • FUCA1
    • FUCO_HUMAN
    • fucosidase, alpha-L, tissue
    • fucosidase, alpha-L- 1, tissue
    • Tissue alpha L fucosidase
    • Tissue alpha-L-fucosidase
    see all
  • Function

    Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.
  • Involvement in disease

    Defects in FUCA1 are the cause of fucosidosis (FUCA1D) [MIM:230000]. FUCA1D is an autosomal recessive lysosomal storage disease characterized by accumulation of fucose-containing glycolipids and glycoproteins in various tissues. Clinical signs include facial dysmorphism, dysostosis multiplex, moderate hepatomegaly, severe intellectual deficit, deafness, and according to age, angiokeratomas.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 29 family.
  • Cellular localization

    Lysosome.
  • Information by UniProt

References

ab226241 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226241.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up