For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-mouse-g-csf-protein-ab9752.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Cytokines CSFs
Share by email

Recombinant mouse G-CSF protein (ab9752)

  • Datasheet
Submit a review Q&A (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Expression system: Escherichia coli
  • Endotoxin level: < 0.100 Eu/µg
  • Active: Yes
  • Suitable for: SDS-PAGE, Functional Studies

You may also be interested in

ELISA
Product image
Mouse G-CSF ELISA Kit (CSF3) (ab197743)

View more associated products

Description

  • Product name

    Recombinant mouse G-CSF protein
    See all G-CSF proteins and peptides
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

    P09920
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCH PEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALS GISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSA FQRRAGGVLAISYLQGFLETARLALHHLA
    • Predicted molecular weight

      22 kDa
    • Amino acids

      31 to 208

Associated products

    Specifications

    Our Abpromise guarantee covers the use of ab9752 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

      Functional Studies

    • Form

      Lyophilized
    • Additional notes

      The ED50, determined by the dose-dependent stimulation of the proliferation of murine NSF-60 cells, is < 0.05 ng/ml, corresponding to a specific activity of > 2 x 107 units/mg

    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      For lot specific reconstitution information please contact our Scientific Support Team.

    General Info

    • Alternative names

      • C17orf33
      • Colony stimulating factor 3
      • Colony stimulating factor 3 (granulocyte)
      • CSF 3
      • CSF beta
      • CSF3
      • CSF3_HUMAN
      • CSF3OS
      • Csfg
      • Filgrastim
      • G-CSF
      • GCSA
      • GCSF
      • Granulocyte colony stimulating factor
      • Granulocyte colony-stimulating factor
      • Lenograstim
      • Macrophage granulocyte inducer 2
      • MGC45931
      • MGI 2
      • Pluripoietin
      see all
    • Function

      Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
    • Sequence similarities

      Belongs to the IL-6 superfamily.
    • Post-translational
      modifications

      O-glycan consists of Gal-GalNAc disaccharide which can be modified with up to two sialic acid residues (done in recombinantly expressed G-CSF from CHO cells).
    • Cellular localization

      Secreted.
    • Target information above from: UniProt accession P09919 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab9752? Please let us know so that we can cite the reference in this datasheet.

    ab9752 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    I am interested in ordering recombinant human G-CSF from you. However,there are two products that describe the peptide as "Highly pure (>98%) recombinant hIL-11 (human Interleukin-11)". ab9752 has the recombinant murine sequence whereas ab9692 has the human sequence. Can I therefore assume that ab9692 is the human protein? Also, is IL-11 another name for G-CSF or simply an agonist of the G-CSF receptor?

    Read More

    Abcam community

    Verified customer

    Asked on Jun 02 2005

    Answer

    Thank you for your email. There was a mistake on the datasheets for these proteins - ab9692 is recombinant human G-CSF and ab9752 is recombinant mouse G-CSF. They are not IL-ll proteins. I have updated the online datasheets to reflect this information. So, it sounds like what you want is ab9692, the recombinant human G-CSF. If you have any additional questions, please contact us again.

    Read More

    Abcam Scientific Support

    Answered on Jun 03 2005

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.