For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-mouse-g-csf-protein-active-ab243120.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Cytokines CSFs
Share by email
Bioactive grade

Recombinant mouse G-CSF protein (Active) (ab243120)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant mouse G-CSF protein (Active) (ab243120)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 98% SDS-PAGE
    • Endotoxin level: < 1.000 Eu/µg
    • Active: Yes
    • Suitable for: Functional Studies, SDS-PAGE, HPLC

    You may also be interested in

    ELISA
    Product image
    Mouse G-CSF ELISA Kit (CSF3) (ab197743)

    View more associated products

    Description

    • Product name

      Recombinant mouse G-CSF protein (Active)
      See all G-CSF proteins and peptides
    • Biological activity

      Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS 60 cells is less than 0.05 ng/ml, corresponding to a specific activity of >2.0x107 IU/mg.

    • Purity

      > 98 % SDS-PAGE.
      >98 % by HPLC.
    • Endotoxin level

      < 1.000 Eu/µg
    • Expression system

      Escherichia coli
    • Accession

      P09920
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Mouse
      • Sequence

        VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHP EELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSG ISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAF QRRAGGVLAISYLQGFLETARLALHHLA
      • Predicted molecular weight

        19 kDa
      • Amino acids

        31 to 208
      • Additional sequence information

        This product is the mature full length protein from aa 31 to 208. The signal peptide is not included.

    Associated products

      Specifications

      Our Abpromise guarantee covers the use of ab243120 in the following tested applications.

      The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

      • Applications

        Functional Studies

        SDS-PAGE

        HPLC

      • Form

        Lyophilized
      • Concentration information loading...

      Preparation and Storage

      • Stability and Storage

        Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

        Constituents: 0.29% Sodium citrate, 0.87% Sodium chloride, 0.01% Tween

        0.2 m filtered.

        This product is an active protein and may elicit a biological response in vivo, handle with caution.

      • Reconstitution
        Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.

      General Info

      • Alternative names

        • C17orf33
        • Colony stimulating factor 3
        • Colony stimulating factor 3 (granulocyte)
        • CSF 3
        • CSF beta
        • CSF3
        • CSF3_HUMAN
        • CSF3OS
        • Csfg
        • Filgrastim
        • G-CSF
        • GCSA
        • GCSF
        • Granulocyte colony stimulating factor
        • Granulocyte colony-stimulating factor
        • Lenograstim
        • Macrophage granulocyte inducer 2
        • MGC45931
        • MGI 2
        • Pluripoietin
        see all
      • Function

        Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
      • Sequence similarities

        Belongs to the IL-6 superfamily.
      • Post-translational
        modifications

        O-glycan consists of Gal-GalNAc disaccharide which can be modified with up to two sialic acid residues (done in recombinantly expressed G-CSF from CHO cells).
      • Cellular localization

        Secreted.
      • Target information above from: UniProt accession P09919 The UniProt Consortium
        The Universal Protein Resource (UniProt) in 2010
        Nucleic Acids Res. 38:D142-D148 (2010) .

        Information by UniProt

      Images

      • SDS-PAGE - Recombinant mouse G-CSF protein (Active) (ab243120)
        SDS-PAGE - Recombinant mouse G-CSF protein (Active) (ab243120)
        SDS Page analysis of ab243120

      Protocols

      To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

      Click here to view the general protocols

      Datasheets and documents

      • Datasheet
    • References (0)

      Publishing research using ab243120? Please let us know so that we can cite the reference in this datasheet.

      ab243120 has not yet been referenced specifically in any publications.

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      There are currently no Customer reviews or Questions for ab243120.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.