Recombinant mouse G-CSF protein (Active) (ab243120)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, HPLC
Description
-
Product name
Recombinant mouse G-CSF protein (Active)
See all G-CSF proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS 60 cells is less than 0.05 ng/ml, corresponding to a specific activity of >2.0x107 IU/mg.
-
Purity
> 98 % SDS-PAGE.
>98 % by HPLC. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHP EELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSG ISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAF QRRAGGVLAISYLQGFLETARLALHHLA -
Predicted molecular weight
19 kDa -
Amino acids
31 to 208 -
Additional sequence information
This product is the mature full length protein from aa 31 to 208. The signal peptide is not included.
-
Associated products
Specifications
Our Abpromise guarantee covers the use of ab243120 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: 0.29% Sodium citrate, 0.87% Sodium chloride, 0.01% Tween
0.2 m filtered.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- C17orf33
- Colony stimulating factor 3
- Colony stimulating factor 3 (granulocyte)
see all -
Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes. -
Sequence similarities
Belongs to the IL-6 superfamily. -
Post-translational
modificationsO-glycan consists of Gal-GalNAc disaccharide which can be modified with up to two sialic acid residues (done in recombinantly expressed G-CSF from CHO cells). -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243120 has not yet been referenced specifically in any publications.