Description

  • Product name

    Recombinant Mouse GAL4 protein
    See all GAL4 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab136705 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAYVPAPGYQPTYNPTLPYKRPIPGGL SVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFN TMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHR LPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNP PQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVI NFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFF DLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      1 to 326
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab136705 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Antigen NY CO 27
    • Antigen NY-CO-27
    • Antigen NYCO27
    • GAL 4
    • Gal-4
    • GAL4
    • Galectin 4
    • Galectin-4
    • Galectin4
    • Homo sapiens galectin4 mRNA complete cds
    • L 36 lactose binding protein
    • L-36 lactose-binding protein
    • L36 lactose binding protein
    • L36LBP
    • Lactose binding lectin 4
    • Lactose-binding lectin 4
    • Lectin galactoside binding soluble 4
    • LEG4_HUMAN
    • LGALS4
    see all
  • Function

    Galectin that binds lactose and a related range of sugars. May be involved in the assembly of adherens junctions.
  • Sequence similarities

    Contains 2 galectin domains.
  • Domain

    Contains two homologous but distinct carbohydrate-binding domains.
  • Information by UniProt

Images

  • 15% SDS-PADE analysis of 3 µg ab136705.

References

ab136705 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab136705.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up