Description

  • Product name

    Recombinant mouse Galectin 3 protein (Active)
    See all Galectin 3 proteins and peptides
  • Biological activity

    The ED50 for this effect is ≤25 ug/ml. Measured by its ability to agglutinate human red blood cells

  • Purity

    > 95 % SDS-PAGE.
    ab224635 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMADSFSLNDALAGSGNPNPQGYPGAWG NQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAP GAYPGPTAPGAYPGSTAPGAFPGQPGAPGAYPSAPGGYPAAGPYGVPAGP LTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRF NENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAV NDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      1 to 264
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_034835.

Specifications

Our Abpromise guarantee covers the use of ab224635 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.06% EDTA, 50% Glycerol, 0.87% Sodium chloride, 0.32% Tris HCl

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 35 kDa lectin
    • Carbohydrate binding protein 35
    • Carbohydrate-binding protein 35
    • CBP 35
    • CBP35
    • Gal-3
    • GAL3
    • Galactose-specific lectin 3
    • Galactoside-binding protein
    • GALBP
    • Galectin 3 internal gene,included
    • Galectin-3
    • Galectin3
    • GALIG
    • GBP
    • IgE binding protein
    • IgE-binding protein
    • L 31
    • L 34
    • L-31
    • L-34 galactoside-binding lectin
    • L31
    • Laminin-binding protein
    • Lectin L-29
    • Lectin, galactose binding, soluble 3
    • LEG3_HUMAN
    • LGALS2
    • LGALS3
    • MAC 2 antigen
    • Mac-2
    • Mac-2 antigen
    • MAC2
    • Macrophage galactose-specific lectin
    • MGC105387
    see all
  • Function

    Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis.
  • Tissue specificity

    A major expression is found in the colonic epithelium. It is also abundant in the activated macrophages.
  • Sequence similarities

    Contains 1 galectin domain.
  • Cellular localization

    Nucleus. Cytoplasmic in adenomas and carcinomas. May be secreted by a non-classical secretory pathway and associate with the cell surface.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab224635.

References

ab224635 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224635.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up