Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMLSLNNLQNIIYNPIIPYVGTITEQLK PGSLIVIRGHVPKDSERFQVDFQLGNSLKPRADVAFHFNPRFKRSSCIVC NTLTQEKWGWEEITYDMPFRKEKSFEIVFMVLKNKFQVAVNGRHVLLYAH RISPEQIDTVGIYGKVNIHSIGFRFSSDLQSMETSALGLTQINRENIQKP GKLQLSLPFEARLNASMGPGRTVVIKGEVNTNARSFNVDLVAGKTRDIAL HLNPRLNVKAFVRNSFLQDAWGEEERNITCFPFSSGMYFEMIIYCDVREF KVAINGVHSLEYKHRFKDLSSIDTLSVDGDIRLLDVRSW
    • Molecular weight

      38 kDa including tags
    • Amino acids

      1 to 316
    • Tags

      His tag N-Terminus
    • Additional sequence information

      The protein sequence contains MGSSHHHHHHSSGLVPRGSHMGS sequence at N-Terminus for the His tag.

Specifications

Our Abpromise guarantee covers the use of ab134629 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab134629 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

    Previously labelled as Galectin 8. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • Gal 8
    • Gal-8
    • Gal8
    • Galectin 8
    • Galectin-8
    • galectin-8g
    • Lectin galactoside binding soluble 8
    • LEG8_HUMAN
    • LGAL S8
    • Lgals8
    • PCTA 1
    • PCTA-1
    • PCTA1
    • Po66 carbohydrate binding protein
    • Po66 carbohydrate-binding protein
    • Po66 CBP
    • Po66-CBP
    • Prostate carcinoma tumor antigen 1
    see all
  • Tissue specificity

    Ubiquitous. Selective expression by prostate carcinomas versus normal prostate and benign prostatic hypertrophy.
  • Sequence similarities

    Contains 2 galectin domains.
  • Domain

    Contains two homologous but distinct carbohydrate-binding domains.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab134629 (3µg)

References

ab134629 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134629.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up