Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMALFSAQSPYINPIIPFTGPIQGGLQE GLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQ NGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPY HLVDTIAVSGCLKLSFITFQTQNFRPAHQAPMAQTTIHMVHSTPGQMFST PGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRC GGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWI ICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT
    • Molecular weight

      38 kDa including tags
    • Amino acids

      1 to 322
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139256 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

    Previously labelled as galectin 9. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • 36 kDa beta-galactoside-binding lectin
    • Ecalectin
    • Gal-9
    • galectin 9
    • Galectin-9
    • galectin9
    • HOM HD 21
    • HOMHD21
    • HUAT
    • Lectin galactoside binding soluble 9
    • LEG9_HUMAN
    • LGAL S9
    • LGALS 9
    • Lgals9
    • LGALS9A
    • MGC117375
    • MGC125973
    • MGC125974
    • Tumor antigen HOM-HD-21
    • UAT
    • Urate transporter/channel
    • Urate transporter/channel protein
    see all
  • Function

    Binds galactosides. Has high affinity for the Forssman pentasaccharide. May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. Inhibits cell proliferation. It is a ligand for HAVCR2/TIM3. Induces T-helper type 1 lymphocyte (Th1) death. Isoform Short acts as an eosinophil chemoattractant.
  • Tissue specificity

    Peripheral blood leukocytes and lymphatic tissues. Overexpressed in Hodgkin disease tissue.
  • Sequence similarities

    Contains 2 galectin domains.
  • Domain

    Contains two homologous but distinct carbohydrate-binding domains.
  • Cellular localization

    Cytoplasm. Secreted. May also be secreted by a non-classical secretory pathway.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139256.

References

ab139256 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139256.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up